PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G41170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 324aa    MW: 33959.3 Da    PI: 6.8277
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G41170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP124.51.2e-3885173391
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91 
                      +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+pai ++tgt++++as+  +++ s  + ns  +++ 
  OPUNC01G41170.1  85 PKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEPAIVAATGTGTIPASALASVAPSLPSPNSALSRSH 173
                      6999***********************************************************99999766222222222222222111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.8E-3389282IPR005333Transcription factor, TCP
PROSITE profilePS5136928.03990144IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MDPKFPPPPP LNKTEPTTTT TTTTTTNQQH HHDEQQQHRL QIQVHPQQQE QDGGGGGKDQ  60
QQQQQQMQVV AVAAAGERRM QGLGPKRSSN KDRHTKVDGR GRRIRMPALC AARIFQLTRE  120
LGHKSDGETV QWLLQQAEPA IVAATGTGTI PASALASVAP SLPSPNSALS RSHHHHHHMW  180
AAAAAPAASA GFAGAGFSGA DSGVIGGIMQ RMGLPAGIEL QGGGAGGLGG GGGGHIGFAP  240
MFAGHAAAAM PGLELGLSQD GHIGVLAAQS LSQFYHQVGG AGAAGQLPHP HQHHHHQHHQ  300
QQQQQQEDGE DDRDDGESDE ESGQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8321960.0CT832196.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA111A24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621786.11e-127PREDICTED: transcription factor TCP20
SwissprotQ9LSD53e-50TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A0E0JSZ20.0A0A0E0JSZ2_ORYPU; Uncharacterized protein
STRINGBGIOSGA005085-PA1e-118(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-39TCP family protein